Review



position-specific iterated blast (psi-blast) algorithm  (Biotechnology Information)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    Biotechnology Information position-specific iterated blast (psi-blast) algorithm
    Position Specific Iterated Blast (Psi Blast) Algorithm, supplied by Biotechnology Information, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/position-specific+iterated+blast+(psi-blast)+algorithm/position+specific+iterated+blast/pm33879858-199-8-20
    Average 90 stars, based on 1 article reviews
    position-specific iterated blast (psi-blast) algorithm - by Bioz Stars, 2026-10
    90/100 stars

    Images

    Related Articles

    other:

    Article Title: Genomic and phenotypic characterization of Rhizobium gallicum phage vB_RglS_P106B.
    Article Snippet: Putative products of the predicted 164 ORFs were compared against the database of National Center for Biotechnology Information 165 (NCBI) using standard protein BLAST with the PSI -BLAST (Position-Specific Iterated 166 10 BLAST) algorithm (Altschul et al., 1997).

    Article Title: Discovery of Nigri/ nox and Panto/ pox site-specific recombinase systems facilitates advanced genome engineering
    Article Snippet: The search for potential Cre-like SSRs was performed using the position-specific iterated Basic Local Alignment Search Tool algorithm [PSI-BLAST/National Center for Biotechnology Information (NCBI)] on the non-redundant sequences in the public DNA database of the NCBI ( http://blast.ncbi.nlm.nih.gov/ ) and BLAST algorithm in ACLAME database .

    Article Title: Vika/ vox , a novel efficient and specific Cre/ loxP -like site-specific recombination system
    Article Snippet: The search for potential Cre-like SSRs was performed using the position-specific iterated Basic Local Alignment Search Tool (BLAST) algorithm [PSI-BLAST/National Center for Biotechnology Information (NCBI)] on the non-redundant sequences in the public DNA database of the NCBI ( http://blast.ncbi.nlm.nih.gov/ , date of search: 28 October 2010).

    Article Title: SARS-CoV-2 spike protein dictates syncytium-mediated lymphocyte elimination
    Article Snippet: The pre-cleavage motif was identified by Position-Specific Iterated BLAST (PSI-BLAST) algorithm queried with sequence “GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNS” at the National Center for Biotechnology Information ( https://blast.ncbi.nlm.nih.gov/ ).

    Article Title: Drosophila Ana2 is a conserved centriole duplication factor
    Article Snippet: The position-specific iterated BLAST (PSI-BLAST) algorithm ( ) from the National Center for Biotechnology Information was used to search for homologues of Ana2.

    Article Title: SARS-CoV-2 spike protein dictates syncytium-mediated lymphocyte elimination.
    Article Snippet: The pre-cleavage motif was identified by Position-Specific Iterated BLAST (PSI-BLAST) algorithm queried with sequence “GAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNS” at the National Center for Biotechnology Information (https://blast.ncbi.nlm.nih.gov/).

    Article Title: Comparison of Transformer Winding Methods for Contactless Power Transfer Systems of Electric Vehicle
    Article Snippet: 126 Genes related to lignin depolymerization in strain S11Y were manually annotated by 127 performing a homology search against reference genomes using the PSI-BLASTP 128 (Position-Specific Iterated BLAST) algorithm from the National Center for 129 Biotechnology Information (NCBI).

    In Silico:




    Similar Products

    position-specific iterated blast (psi-blast) algorithm  (Biotechnology Information)
    90
    Biotechnology Information position-specific iterated blast (psi-blast) algorithm
    Position Specific Iterated Blast (Psi Blast) Algorithm, supplied by Biotechnology Information, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/position-specific+iterated+blast+(psi-blast)+algorithm/position+specific+iterated+blast/pm33879858-199-8-20
    Average 90 stars, based on 1 article reviews
    position-specific iterated blast (psi-blast) algorithm - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier

    Image Search Results